HORDB

ID: hor002048
Uniprot ID: O97655
Protein name: Progonadoliberin-2
Gene name: GNRH2
Organism: Macaca mulatta (Rhesus macaque)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSHGWYPGGKRALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
Length: 90
Propeptide: MASSRRGLLLLLMLLTAHPGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
Signal peptide: MASSRRGLLLLLMLLTAHPGPSEA
Modification: T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: NA
Cross BBB: NA
Target: GNRHR2
Target Unid: Q95JG1
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002048_AF2.pdb

hor002048_ESM.pdb

Mass:	1160392	Formula:	C446H683N135O126S2
Absent amino acids:	CFI	Common amino acids:	AP
pI:	10.75	Basic residues:	14
Polar residues:	24	Hydrophobic residues:	28
Hydrophobicity:	-81.33	Boman Index:	-18279
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	58.78
Instability Index:	7693.67	Extinction Coefficient cystines:	31970
Absorbance 280nm:	359.21