General Information

  • ID:  hor002048
  • Uniprot ID:  O97655
  • Protein name:  Progonadoliberin-2
  • Gene name:  GNRH2
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKRALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
  • Length:  90(25-114)
  • Propeptide:  MASSRRGLLLLLMLLTAHPGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
  • Signal peptide:  MASSRRGLLLLLMLLTAHPGPSEA
  • Modification:  T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GNRHR2
  • Target Unid:  Q95JG1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97655-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002048_AF2.pdbhor002048_ESM.pdb

Physical Information

Mass: 1160392 Formula: C446H683N135O126S2
Absent amino acids: CFI Common amino acids: AP
pI: 10.75 Basic residues: 14
Polar residues: 24 Hydrophobic residues: 28
Hydrophobicity: -81.33 Boman Index: -18279
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 58.78
Instability Index: 7693.67 Extinction Coefficient cystines: 31970
Absorbance 280nm: 359.21

Literature

  • PubMed ID:  NA
  • Title:  NA